What is the catalog number for WNV Envelope Protein?

The catalog number for WNV Envelope Protein is OPPA01492-100UG.

What sizes are available for WNV Envelope Protein?

WNV Envelope Protein is available in the following size(s): 100 µg.

Is WNV Envelope Protein in stock?

WNV Envelope Protein is currently made to order / not held in immediate stock. Contact us for lead time.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

WNV Envelope Protein

Selected Variant

OPPA01492-100UG

Size: 100 µg

Product Specifications

Gene Aliases

WNV Envelope, West Nile Virus Envelope Recombinant

Reactivity

West Nile Virus

Target

West Nile virus (WNV) is a virus of the family Flaviviridae part of the Japanese encephalitis (JE) antigenic complex of viruses. Image reconstructions and cryoelectron microscopyreveal a 45-50 nm virion covered with a relatively smooth proteinsurface. This structure is similar to virus; both belong to the genus flavivirus within the family Flaviviridae. WNV is a positive-sense, single strand of RNA, it is between 11,000 and 12,000 nucleotides long which encode seven non-structural proteins and three structural proteins. The RNA strand is held within a nucleocapsid formed from 12 kDaprotein blocks; the capsid is contained within a host-derived membrane altered by two viral glycoproteins.

Type

Protein

Source

E.coli

Sequence

MQLKGTTYGVCSKAFKFLGTPADTGHGTVVLELQYTGTDGPCKVPISSVASLNDLTPVGRLVTVNPFVSVATANAKVLIELEPPFGDSYIVVGRGEQQINHHWHKSGSSIGKAFTTTLKGALE.

Applications

ELISA, WB

Purification

Purified by proprietary chromatographic technique.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid.// 20mM Phosphate buffer pH 7.5.

Reconstitution

Stability: //Five years frozen. One month in solution at room temperature.

Notes

Formerly GWB-57821D

Specificity

Immunoreactive with sera of West Nile virus infected individuals.

Protein Length

Recombinant

NCBI Gene Symbol

WNV ENVELOPE

Gene Name URL

WNV Envelope

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thymidylate Synthase (TS106), CF647 conjugate, 0.1mg/mL

BNC470714-500 1x 500 µL