What is the catalog number for Protein G Protein?

The catalog number for Protein G Protein is OPPA01314-1MG.

What sizes are available for Protein G Protein?

Protein G Protein is available in the following size(s): 1 mg.

Is Protein G Protein in stock?

Protein G Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Protein G Protein

Recombinant streptococcal protein G lacking the albumin binding region thereby avoiding undesirable reactions with albumin, though the Fc binding domain is still present. The recombinant Protein G is produced in Escherichia coli using sequence from Streptococcus C1-C2-C3. The Protein G contains amino acids 190-384. The Protein-G migrates on SDS-PAGE around 32 kDa.

Product Specifications

Gene Aliases

Protein G, Protein G Recombinant

Target

Recombinant Protein G

Type

Protein

Sequence

LPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol