What is the catalog number for UBE2D3 Protein?

The catalog number for UBE2D3 Protein is OPPA00860-2UG.

What sizes are available for UBE2D3 Protein?

UBE2D3 Protein is available in the following size(s): 2 µg.

Is UBE2D3 Protein in stock?

UBE2D3 Protein is currently made to order / not held in immediate stock. Contact us for lead time.

UBE2D3 Protein

Product Specifications

Gene Aliases

UBC4/5, UBCH5C, E2 (17) KB3

Gene ID

7323

Accession Number

NP_003331.1

Reactivity

Human

Target

Recombinant Human Ubiquitin Conjugating Enzyme E2D3

Type

Protein

Sequence

MHHHHHHAMALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Lyophilized from a 0.2um filtered concentrated (1 mg/ml) solution in 1X PBS and 1mM DTT, pH 7.5. Physical appearance: Sterile Filtered white lyophilized powder.

Reconstitution

Lyophilized UBE2D3 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution UBE2D3 should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA) . Please prevent freeze-thaw cycles.