Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF, Human (His)

The MIF protein is a pro-inflammatory cytokine that is critical for the innate immune response against bacterial pathogens. Its presence at sites of inflammation suggests a role in modulating macrophage function to promote host defense. MIF Protein, Human (His) is the recombinant human-derived MIF protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MIF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mif-protein-human-n-his.html

Purity

95.0

Smiles

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Molecular Formula

4282 (Gene_ID) P14174 (M1-A115) (Accession)

Molecular Weight

Approximately 11.67 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2166R), 1mg/mL
BNUM2166-50 1x 50 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2166R), 1mg/mL

Sign In for Pricing
View Details
2,3,5-Tri-O-benzyl-D-ribono-1,4-lactone
TRC-T771378-5G 5 g

2,3,5-Tri-O-benzyl-D-ribono-1,4-lactone

Sign In for Pricing
View Details
FSH Receptor (FSHR) Rabbit Polyclonal Antibody
AP01215PU-N 100 µg

FSH Receptor (FSHR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AGAP5 (NM_001144000) Human Over-expression Lysate
LY428460 100 µg

AGAP5 (NM_001144000) Human Over-expression Lysate

Sign In for Pricing
View Details
IL-4R/CD124 (Ab-497) Antibody
8B1064-AAT 50 µg

IL-4R/CD124 (Ab-497) Antibody

Sign In for Pricing
View Details
SLC2A7 Human Gene Knockout Kit (CRISPR)
KN423223 1 Kit

SLC2A7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details