Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF, Human (His)

The MIF protein is a pro-inflammatory cytokine that is critical for the innate immune response against bacterial pathogens. Its presence at sites of inflammation suggests a role in modulating macrophage function to promote host defense. MIF Protein, Human (His) is the recombinant human-derived MIF protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MIF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mif-protein-human-n-his.html

Purity

95.0

Smiles

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Molecular Formula

4282 (Gene_ID) P14174 (M1-A115) (Accession)

Molecular Weight

Approximately 11.67 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DGAT2L6 Human qPCR Primer Pair (NM_198512)
HP219367 200 Reactions

DGAT2L6 Human qPCR Primer Pair (NM_198512)

Sign In for Pricing
View Details
PSMB1 Rabbit Polyclonal Antibody
HA500545 100 µL

PSMB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD117 Rat Monoclonal Antibody [Clone ID: ACK4]
TA363843 200 µg

CD117 Rat Monoclonal Antibody [Clone ID: ACK4]

Sign In for Pricing
View Details
Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Human IgG, Fc Fragment
HAF-311-1 1 mL

Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Human IgG, Fc Fragment

Sign In for Pricing
View Details
SLC9A3R2 Rabbit Polyclonal Antibody
TA381714 100 µL

SLC9A3R2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SARS-CoV-2 Spike RBD Protein, His Tag (BA.2/Omicron) (MALS verified)
SPD-C522n-1mg 1 mg

SARS-CoV-2 Spike RBD Protein, His Tag (BA.2/Omicron) (MALS verified)

Sign In for Pricing
View Details