Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF, Human (His)

The MIF protein is a pro-inflammatory cytokine that is critical for the innate immune response against bacterial pathogens. Its presence at sites of inflammation suggests a role in modulating macrophage function to promote host defense. MIF Protein, Human (His) is the recombinant human-derived MIF protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MIF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mif-protein-human-n-his.html

Purity

95.0

Smiles

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Molecular Formula

4282 (Gene_ID) P14174 (M1-A115) (Accession)

Molecular Weight

Approximately 11.67 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRF41 (PAPD7) Rabbit Polyclonal Antibody
TA379622 100 µL

TRF41 (PAPD7) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human PCDHAC1 activation kit by CRISPRa
GA111127 1 Kit

Human PCDHAC1 activation kit by CRISPRa

Sign In for Pricing
View Details
Dual Purpose Incubator BIDP-205
BIDP-205 1 Unit

Dual Purpose Incubator BIDP-205

Sign In for Pricing
View Details
UBE2L3 (NM_003347) Human Over-expression Lysate
LC401144 20 µg

UBE2L3 (NM_003347) Human Over-expression Lysate

Sign In for Pricing
View Details
Prostate Specific Antigen (KLK3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C8]
TA808292AM 100 µL

Prostate Specific Antigen (KLK3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C8]

Sign In for Pricing
View Details
(-)-Huperzine A
TRC-H826000-1MG 1 mg

(-)-Huperzine A

Sign In for Pricing
View Details