Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF, Human (His)

The MIF protein is a pro-inflammatory cytokine that is critical for the innate immune response against bacterial pathogens. Its presence at sites of inflammation suggests a role in modulating macrophage function to promote host defense. MIF Protein, Human (His) is the recombinant human-derived MIF protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MIF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mif-protein-human-n-his.html

Purity

95.0

Smiles

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Molecular Formula

4282 (Gene_ID) P14174 (M1-A115) (Accession)

Molecular Weight

Approximately 11.67 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WY-14643
SIH-531-50MG 50 mg

WY-14643

Sign In for Pricing
View Details
Human CASKIN2 activation kit by CRISPRa
GA111551 1 Kit

Human CASKIN2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human PAI1 Recombinant Rabbit monoclonal Antibody
HA723438 100 µL

Human PAI1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI7A2]
CF805414 100 µg

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI7A2]

Sign In for Pricing
View Details
KHDC1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G6]
TA810622BM 100 µL

KHDC1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G6]

Sign In for Pricing
View Details
RARRES1 Antibody
KC-7769-01 50 μL

RARRES1 Antibody

Sign In for Pricing
View Details