Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF, Human (His)

The MIF protein is a pro-inflammatory cytokine that is critical for the innate immune response against bacterial pathogens. Its presence at sites of inflammation suggests a role in modulating macrophage function to promote host defense. MIF Protein, Human (His) is the recombinant human-derived MIF protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MIF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mif-protein-human-n-his.html

Purity

95.0

Smiles

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Molecular Formula

4282 (Gene_ID) P14174 (M1-A115) (Accession)

Molecular Weight

Approximately 11.67 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,17-β-Estradiol-3-methylether-17-decanoate
CS-T-54253 1 Each

3,17-β-Estradiol-3-methylether-17-decanoate

Sign In for Pricing
View Details
CPNE1 (NM_152926) Human Tagged Lenti ORF Clone
RC221253L3 10 µg

CPNE1 (NM_152926) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-TYK2 (Phospho-Tyr1054)
orb1140079 100 µg

Anti-TYK2 (Phospho-Tyr1054)

Sign In for Pricing
View Details
I-309 Protein, Human, Recombinant (hFc Tag)
MBS8119972-01 0.1 mg

I-309 Protein, Human, Recombinant (hFc Tag)

Sign In for Pricing
View Details
I-309 Protein, Human, Recombinant (hFc Tag)
MBS8119972-02 5x 0.1 mg

I-309 Protein, Human, Recombinant (hFc Tag)

Sign In for Pricing
View Details
Ndufb10 3'UTR Luciferase Stable Cell Line
TU213839 1.0 mL

Ndufb10 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details