Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant SARS-CoV-2 Spike Glycoprotein

Product Specifications

CAS Number

9000-83-3

Gene Name

Surface glycoprotein

Gene Aliases

E2; GU280_gp02; Peplomer protein; spike glycoprotein; surface glycoprotein.

Gene ID

43740568

Reactivity

SARS-CoV-2 / COVID-19 Virus|Severe acute respiratory syndrome coronavirus 2

Target

Attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Binding to human ACE2 receptor and internalization of the virus into the endosomes of the host cell induces conformational changes in the Spike glycoprotein (PubMed:32142651, PubMed:32221306, PubMed:32075877, PubMed:32155444) . Binding to host NRP1 and NRP2 via C-terminal polybasic sequence enhances virion entry into host cell (PubMed:33082294, PubMed:33082293) . This interaction may explain virus tropism of human olfactory epithelium cells, which express high level of NRP1 and NRP2 but low level of ACE2 (PubMed:33082293) . The stalk domain of S contains three hinges, giving the head unexpected orientational freedom (PubMed:32817270) . Uses human TMPRSS2 for priming in human lung cells which is an essential step for viral entry (PubMed:32142651) . Can be alternatively processed by host furin (PubMed:32362314) . Proteolysis by cathepsin CTSL may unmask the fusion peptide of S2 and activate membrane fusion within endosomes.

Type

Protein

Source

Mammalian Cells

Sequence

VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR

Applications

SDS-PAGE

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Bioactivity

1. Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S at 2 ug/ml can bind human ACE2 , the EC50 of SARS-CoV-2-S protein is 56.64 - 103.6 ng/ml._x005F 2. Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S at 2 ug/ml can bind SARS-CoV-2-S Antibody , the EC50 of SARS-CoV-2-S protein is 36.79-48.87 ng/ml.

Format

Lyophilized

Reconstitution

-20°C or -80°C

Molecular Weight

79.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

S

Protein Name

Spike glycoprotein

Gene Name URL

S

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Lipocalin 2 (LCN2) ELISA Kit
MBS2611212-01 48 Well

Canine Lipocalin 2 (LCN2) ELISA Kit

Sign In for Pricing
View Details
Canine Lipocalin 2 (LCN2) ELISA Kit
MBS2611212-02 96 Well

Canine Lipocalin 2 (LCN2) ELISA Kit

Sign In for Pricing
View Details
Canine Lipocalin 2 (LCN2) ELISA Kit
MBS2611212-03 5x 96 Well

Canine Lipocalin 2 (LCN2) ELISA Kit

Sign In for Pricing
View Details
Canine Lipocalin 2 (LCN2) ELISA Kit
MBS2611212-04 10x 96 Well

Canine Lipocalin 2 (LCN2) ELISA Kit

Sign In for Pricing
View Details
TNFR1/TNFRSF1A Protein (C-hFc, Mouse)
P518862 100 µg

TNFR1/TNFRSF1A Protein (C-hFc, Mouse)

Sign In for Pricing
View Details
MC4R/Melanocortin 4 Receptor Antibody
orb1532990 50 µg

MC4R/Melanocortin 4 Receptor Antibody

Sign In for Pricing
View Details