Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM167A Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Family with sequence similarity 167 member A

Gene Aliases

C8orf13; D8S265; DIORA-1; disordered autoimmunity 1; protein FAM167A.

Gene ID

83648

Accession Number

NP_444509

Reactivity

Homo sapiens|Human

Type

Protein

Source

Mammalian Cells

Sequence

MSVPQIHVEEVGAEEGAGAAAPPDDHLRSLKALTEKLRLETRRPSYLEWQARLEEHTWPFPRPAAEPQASLEEGERGGQEPLLPLREAGQHPPSARSASQGARPLSTGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQLMRLRGDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIGVTKMNINSRRFSLC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

28.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FAM167A

Protein Name

Protein FAM167A

Gene Name URL

FAM167A

Nucleotide Accession Number

NM_053279

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oxalic Acid 1% Solution
RRSP166-F 2.5 L

Oxalic Acid 1% Solution

Sign In for Pricing
View Details
Anti-SIRT1 (Recombinant Rabbit, Monoclonal, IgG)
A121020 100 µL

Anti-SIRT1 (Recombinant Rabbit, Monoclonal, IgG)

Sign In for Pricing
View Details
COL6A (3C4) Alexa Fluor® 594
sc-47712 AF594 200 µg/mL

COL6A (3C4) Alexa Fluor® 594

Sign In for Pricing
View Details
CIDEA 3'UTR Lenti-reporter-Luc Vector
16186081 1.0 µg

CIDEA 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
CCL18 (C-C Motif Chemokine 18, Alternative Macrophage Activation-associated CC Chemokine 1, AMAC-1, CC Chemokine PARC, Dendritic Cell Chemokine 1, DC-CK1, Macrophage Inflammatory Protein 4, MIP-4, Pulmonary and Activation-regulated Chemokine, Small-inducible Cytokine A18, AMAC1, DCCK1, MIP4, PARC, SCYA18) (MaxLight 550)
124450-ML550 100 µL

CCL18 (C-C Motif Chemokine 18, Alternative Macrophage Activation-associated CC Chemokine 1, AMAC-1, CC Chemokine PARC, Dendritic Cell Chemokine 1, DC-CK1, Macrophage Inflammatory Protein 4, MIP-4, Pulmonary and Activation-regulated Chemokine, Small-inducible Cytokine A18, AMAC1, DCCK1, MIP4, PARC, SCYA18) (MaxLight 550)

Sign In for Pricing
View Details
AMCAP™ mCherry mRNA
MAMC117 1 mg

AMCAP™ mCherry mRNA

Sign In for Pricing
View Details