Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HINT1 Recombinant Protein (Rabbit)

Product Specifications

CAS Number

9000-83-3

Gene Name

Histidine triad nucleotide binding protein 1

Gene Aliases

Adenosine 5'-monophosphoramidase; HINT; histidine triad nucleotide-binding protein 1; P13.7.

Gene ID

100009302

Reactivity

Oryctolagus cuniculus|Rabbit

Target

Functions as enzyme, and as scaffolding protein that modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex and by the complex formed with MITF and CTNNB1. Modulates p53/TP53 levels and p53/TP53-mediated apoptosis. Modulates proteasomal degradation of target proteins by the SCF (SKP2-CUL1-F-box protein) E3 ubiquitin-protein ligase complex (By similarity) . Hydrolyzes purine nucleotide phosphoramidates, including adenosine 5'monophosphoramidate (AMP-NH2), adenosine 5'monophosphomorpholidate (AMP-morpholidate) and guanosine 5'monophosphomorpholidate (GMP-morpholidate) . Hydrolyzes lysyl-AMP (AMP-N-epsilon- (N-alpha-acetyl lysine methyl ester) ) generated by lysine tRNA ligase, lysyl-GMP (GMP-N-epsilon- (N-alpha-acetyl lysine methyl ester) ) and AMP-N-alanine methyl ester. Can also convert adenosine 5'-O-phosphorothioate and guanosine 5'-O-phosphorothioate to the corresponding nucleoside 5'-O-phosphates with concomitant release of hydrogen sulfide.

Type

Protein

Source

Mammalian Cells

Sequence

ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKHISQISAAEDADESLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

17.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HINT1

Protein Name

Histidine triad nucleotide-binding protein 1

Gene Name URL

HINT1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYH6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1374107 1.0 µg DNA

MYH6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
RPS4XP11 ORF Vector (Human) (pORF)
ORF031676 1.0 µg DNA

RPS4XP11 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Xab2 (NM_026156) Mouse Tagged ORF Clone
MG210960 10 µg

Xab2 (NM_026156) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
FavorFilter™ Plasmid Extraction Maxi Kit
FAPD3051 10 Preparations

FavorFilter™ Plasmid Extraction Maxi Kit

Sign In for Pricing
View Details
SCRN3 HDR Plasmid (m)
sc-428944-HDR 20 µg

SCRN3 HDR Plasmid (m)

Sign In for Pricing
View Details
Human Myoglobin (MYO) ELISA Kit
DLR-MYO-Hu-96T 96 Tests

Human Myoglobin (MYO) ELISA Kit

Sign In for Pricing
View Details