Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP90AA1 Recombinant Protein (Pig)

Product Specifications

CAS Number

9000-83-3

Gene Name

Heat shock protein 90 alpha family class A member 1

Gene Aliases

90-kDa heat shock protein; heat shock protein HSP 90-alpha; HSP90; Hspca.

Gene ID

397028

Accession Number

NP_999138

Reactivity

Porcine|Sus scrofa

Target

Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity which is essential for its chaperone activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function. Engages with a range of client protein classes via its interaction with various co-chaperone proteins or complexes, that act as adapters, simultaneously able to interact with the specific client and the central chaperone itself. Recruitment of ATP and co-chaperone followed by client protein forms a functional chaperone. After the completion of the chaperoning process, properly folded client protein and co-chaperone leave HSP90 in an ADP-bound partially open conformation and finally, ADP is released from HSP90 which acquires an open conformation for the next cycle. Apart from its chaperone activity, it also plays a role in the regulation of the transcription machinery. HSP90 and its co-chaperones modulate transcription at least at three different levels. In the first place, they alter the steady-state levels of certain transcription factors in response to various physiological cues. Second, they modulate the activity of certain epigenetic modifiers, such as histone deacetylases or DNA methyl transferases, and thereby respond to the change in the environment. Third, they participate in the eviction of histones from the promoter region of certain genes and thereby turn on gene expression. Binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory response, including TNF secretion by monocytes. Interacts with HECTD1 (via N-terminus) (By similarity) .

Type

Protein

Source

Baculovirus

Sequence

VEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKLYVR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

19.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HSP90AA1

Protein Name

Heat shock protein HSP 90-alpha

Gene Name URL

HSP90AA1

Nucleotide Accession Number

NM_213973

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Septin 4 siRNA (h)
sc-36476 10 µM

Septin 4 siRNA (h)

Sign In for Pricing
View Details
Porcine Interleukin 1 Beta (IL1b) ELISA Kit
MBS4500273-01 48 Tests

Porcine Interleukin 1 Beta (IL1b) ELISA Kit

Sign In for Pricing
View Details
Porcine Interleukin 1 Beta (IL1b) ELISA Kit
MBS4500273-02 96 Tests

Porcine Interleukin 1 Beta (IL1b) ELISA Kit

Sign In for Pricing
View Details
Porcine Interleukin 1 Beta (IL1b) ELISA Kit
MBS4500273-03 5x 96 Tests

Porcine Interleukin 1 Beta (IL1b) ELISA Kit

Sign In for Pricing
View Details
Porcine Interleukin 1 Beta (IL1b) ELISA Kit
MBS4500273-04 10x 96 Tests

Porcine Interleukin 1 Beta (IL1b) ELISA Kit

Sign In for Pricing
View Details
SLIRP/C14orf156 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-21033R-BF488-TR 20 µL

SLIRP/C14orf156 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details