Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLP1R Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Glucagon like peptide 1 receptor

Gene Aliases

GLP-1; GLP1 receptor; GLP-1 receptor; GLP-1R; GLP-1-R; glucagon-like peptide 1 receptor; seven transmembrane helix receptor.

Gene ID

2740

Accession Number

NP_002053

Reactivity

Homo sapiens|Human

Target

G-protein coupled receptor for glucagon-like peptide 1 (GLP-1) (PubMed:8405712, PubMed:8216285, PubMed:7517895, PubMed:19861722, PubMed:26308095, PubMed:27196125, PubMed:28514449) . Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels (PubMed:8405712, PubMed:8216285, PubMed:7517895, PubMed:19861722, PubMed:26308095, PubMed:27196125, PubMed:28514449) . Plays a role in regulating insulin secretion in response to GLP-1 (By similarity) .

Type

Protein

Source

Mammalian Cells

Sequence

RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

18.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GLP1R

Protein Name

Glucagon-like peptide 1 receptor

Gene Name URL

GLP1R

Nucleotide Accession Number

NM_002062

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNG5 AAV Vector (Mouse) (CMV)
22325104 1 µg

GNG5 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Kit Antibody (FITC)
orb1251144 0.5 mg

Kit Antibody (FITC)

Sign In for Pricing
View Details
FBXO10 shRNA Plasmid (m)
sc-145101-SH 20 µg

FBXO10 shRNA Plasmid (m)

Sign In for Pricing
View Details
FITC anti-mouse CD321
GT05964 25 µg

FITC anti-mouse CD321

Sign In for Pricing
View Details
Met Rabbit Polyclonal Antibody
BT-AP11300-01 20 µL

Met Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Met Rabbit Polyclonal Antibody
BT-AP11300-02 50 µL

Met Rabbit Polyclonal Antibody

Sign In for Pricing
View Details