Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A27L Recombinant Protein (Smallpox virus)

Product Specifications

CAS Number

9000-83-3

Gene Name

Hypothetical protein

Gene Aliases

Hypothetical protein; VARVgp134.

Gene ID

1486508

Accession Number

NP_042178

Reactivity

Variola virus|Variola Virus

Target

Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV) . The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion (By similarity) .

Type

Protein

Source

Mammalian Cells

Sequence

MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

15.0 kDa

Protein Length

Recombinant

NCBI Gene Symbol

A30L

Protein Name

14 kDa fusion protein

Gene Name URL

A30L

Nucleotide Accession Number

NC_001611

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse TPBGL shRNA Plasmid
abx984334-01 150 µg

Mouse TPBGL shRNA Plasmid

Sign In for Pricing
View Details
Mouse TPBGL shRNA Plasmid
abx984334-02 300 µg

Mouse TPBGL shRNA Plasmid

Sign In for Pricing
View Details
PCYT1B (NM_001163265) Human Tagged ORF Clone
RG228261 10 µg

PCYT1B (NM_001163265) Human Tagged ORF Clone

Sign In for Pricing
View Details
Kcnk15 siRNA Oligos set (Rat)
25395176 3x 5 nmol

Kcnk15 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Sodium Thiosulphate 0.01N Solution
02531 00500 500 mL

Sodium Thiosulphate 0.01N Solution

Sign In for Pricing
View Details
Rabbit Polyclonal ZMIZ2 Antibody [Janelia Fluor 549]
NBP1-76552JF549 0.1 mL

Rabbit Polyclonal ZMIZ2 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details