Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A27L Recombinant Protein (Smallpox virus)

Product Specifications

CAS Number

9000-83-3

Gene Name

Hypothetical protein

Gene Aliases

Hypothetical protein; VARVgp134.

Gene ID

1486508

Accession Number

NP_042178

Reactivity

Variola virus|Variola Virus

Target

Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV) . The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion (By similarity) .

Type

Protein

Source

Mammalian Cells

Sequence

MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

15.0 kDa

Protein Length

Recombinant

NCBI Gene Symbol

A30L

Protein Name

14 kDa fusion protein

Gene Name URL

A30L

Nucleotide Accession Number

NC_001611

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IgM Isotype Control Antibody (B11/7)
MBS1564642-01 0.1 mg

Mouse IgM Isotype Control Antibody (B11/7)

Sign In for Pricing
View Details
Mouse IgM Isotype Control Antibody (B11/7)
MBS1564642-02 1 mg

Mouse IgM Isotype Control Antibody (B11/7)

Sign In for Pricing
View Details
Mouse IgM Isotype Control Antibody (B11/7)
MBS1564642-03 5x 1 mg

Mouse IgM Isotype Control Antibody (B11/7)

Sign In for Pricing
View Details
Rabbit anti-Bacillus sp. (strain TB-90) ureB Polyclonal Antibody
MBS9017436 Inquire

Rabbit anti-Bacillus sp. (strain TB-90) ureB Polyclonal Antibody

Sign In for Pricing
View Details
Reelin Recombinant Protein Antigen
NBP2-61414PEP 100 µL

Reelin Recombinant Protein Antigen

Sign In for Pricing
View Details
Tlr2 Rabbit Polyclonal Antibody
orb1728185 100 µg

Tlr2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details