Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNA1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Cyclin A1

Gene Aliases

CT146; cyclin-A1; testicular tissue protein Li 34.

Gene ID

8900

Accession Number

NP_001104515

Reactivity

Homo sapiens|Human

Target

May be involved in the control of the cell cycle at the G1/S (start) and G2/M (mitosis) transitions. May primarily function in the control of the germline meiotic cell cycle and additionally in the control of mitotic cell cycle in some somatic cells.

Type

Protein

Source

Baculovirus

Sequence

METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

54.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CCNA1

Protein Name

Cyclin-A1

Gene Name URL

CCNA1

Nucleotide Accession Number

NM_001111045

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBXN2A (NM_181713) Human Tagged Lenti ORF Clone
RC210524L1 10 µg

UBXN2A (NM_181713) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human Heparan Sulfate Proteoglycan (HSPG) ELISA Kit
MBS165265-01 48 Well

Human Heparan Sulfate Proteoglycan (HSPG) ELISA Kit

Sign In for Pricing
View Details
Human Heparan Sulfate Proteoglycan (HSPG) ELISA Kit
MBS165265-02 96 Well

Human Heparan Sulfate Proteoglycan (HSPG) ELISA Kit

Sign In for Pricing
View Details
Human Heparan Sulfate Proteoglycan (HSPG) ELISA Kit
MBS165265-03 5x 96 Well

Human Heparan Sulfate Proteoglycan (HSPG) ELISA Kit

Sign In for Pricing
View Details
Human Heparan Sulfate Proteoglycan (HSPG) ELISA Kit
MBS165265-04 10x 96 Well

Human Heparan Sulfate Proteoglycan (HSPG) ELISA Kit

Sign In for Pricing
View Details
Rat Gamma-aminobutyric acid receptor subunit alpha-1, GABRA1 ELISA Kit
MBS9342109-01 48 Well

Rat Gamma-aminobutyric acid receptor subunit alpha-1, GABRA1 ELISA Kit

Sign In for Pricing
View Details