Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGLEC15 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Sialic acid binding Ig like lectin 15

Gene Aliases

CD33 antigen-like 3; CD33 molecule-like 3; CD33L3; HsT1361; sialic acid-binding Ig-like lectin 15; SIGLEC-15.

Gene ID

284266

Accession Number

NP_998767

Reactivity

Homo sapiens|Human

Target

Binds sialylated glycoproteins.

Type

Protein

Source

Mammalian Cells

Sequence

FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SIGLEC15

Protein Name

Sialic acid-binding Ig-like lectin 15

Gene Name URL

SIGLEC15

Nucleotide Accession Number

NM_213602

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EP300 Knockout Jurkat Polyclonal Cells
ARG13636 1 Million

EP300 Knockout Jurkat Polyclonal Cells

Sign In for Pricing
View Details
Heat Shock Protein Beta 8 (HSPb8) Magnetic Fluorescence Assay Kit
MBS2158227-01 96 Tests

Heat Shock Protein Beta 8 (HSPb8) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Heat Shock Protein Beta 8 (HSPb8) Magnetic Fluorescence Assay Kit
MBS2158227-02 5x 96 Tests

Heat Shock Protein Beta 8 (HSPb8) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Heat Shock Protein Beta 8 (HSPb8) Magnetic Fluorescence Assay Kit
MBS2158227-03 10x 96 Tests

Heat Shock Protein Beta 8 (HSPb8) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
ZNF750 Rabbit Polyclonal Antibody (BF594)
orb2536321 100 µL

ZNF750 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
C20orf107 Polyclonal Antibody
bs-15090R 100 µL

C20orf107 Polyclonal Antibody

Sign In for Pricing
View Details