Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCL10 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

C-X-C motif chemokine ligand 10

Gene Aliases

10 kDa interferon gamma-induced protein; C7; crg-2; C-X-C motif chemokine 10; gamma IP10; gIP-10; IFI10; INP10; interferon-inducible cytokine IP-10; IP-10; mob-1; protein 10 from interferon (gamma) -induced cell line; SCYB10; small inducible cytokine subfamily B (Cys-X-Cys), member 10; small-inducible cytokine B10.

Gene ID

3627

Accession Number

NP_001556

Reactivity

Homo sapiens|Human

Target

Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.

Type

Protein

Source

Mammalian Cells

Sequence

VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

12.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CXCL10

Protein Name

C-X-C motif chemokine 10

Gene Name URL

CXCL10

Nucleotide Accession Number

NM_001565

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine C-C Motif Chemokine 1 (CCL1) ELISA Kit
MBS2612702-01 48 Well

Porcine C-C Motif Chemokine 1 (CCL1) ELISA Kit

Sign In for Pricing
View Details
Porcine C-C Motif Chemokine 1 (CCL1) ELISA Kit
MBS2612702-02 96 Well

Porcine C-C Motif Chemokine 1 (CCL1) ELISA Kit

Sign In for Pricing
View Details
Porcine C-C Motif Chemokine 1 (CCL1) ELISA Kit
MBS2612702-03 5x 96 Well

Porcine C-C Motif Chemokine 1 (CCL1) ELISA Kit

Sign In for Pricing
View Details
Porcine C-C Motif Chemokine 1 (CCL1) ELISA Kit
MBS2612702-04 10x 96 Well

Porcine C-C Motif Chemokine 1 (CCL1) ELISA Kit

Sign In for Pricing
View Details
Galactokinase (GALK1) Antibody
abx145833-01 100 µg

Galactokinase (GALK1) Antibody

Sign In for Pricing
View Details
Galactokinase (GALK1) Antibody
abx145833-02 1 mg

Galactokinase (GALK1) Antibody

Sign In for Pricing
View Details