Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GUCA2B Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Guanylate cyclase activator 2B

Gene Aliases

GCAP-II; guanylate cyclase activator 2B; prepro-uroguanylin; UGN; uroguanylin.

Gene ID

2981

Accession Number

NP_009033

Reactivity

Homo sapiens|Human

Target

Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport.

Type

Protein

Source

Mammalian Cells

Sequence

VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

13.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GUCA2B

Protein Name

Guanylate cyclase activator 2B

Gene Name URL

GUCA2B

Nucleotide Accession Number

NM_007102

More Discoveries

Explore Other Products

Browse additional items from our catalog

Scnn1g AAV siRNA Pooled Vector
43193164 1.0 µg

Scnn1g AAV siRNA Pooled Vector

Sign In for Pricing
View Details
SST Antibody
MBS7122348-01 0.05 mg

SST Antibody

Sign In for Pricing
View Details
SST Antibody
MBS7122348-02 0.1 mg

SST Antibody

Sign In for Pricing
View Details
SST Antibody
MBS7122348-03 5x 0.1 mg

SST Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal S100 calcium binding protein A14 Antibody (S100A14/9077R) [DyLight 405]
NBP3-24305V 0.1 mL

Rabbit Monoclonal S100 calcium binding protein A14 Antibody (S100A14/9077R) [DyLight 405]

Sign In for Pricing
View Details
Cnrip1 Mouse qPCR Primer Pair (NM_029861)
MP201670 200 Reactions

Cnrip1 Mouse qPCR Primer Pair (NM_029861)

Sign In for Pricing
View Details