What is the catalog number for HLA-G Recombinant Protein (Human)?

The catalog number for HLA-G Recombinant Protein (Human) is OPCA05393-100UG.

What sizes are available for HLA-G Recombinant Protein (Human)?

HLA-G Recombinant Protein (Human) is available in the following size(s): 100 µg.

Is HLA-G Recombinant Protein (Human) in stock?

HLA-G Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

HLA-G Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Major histocompatibility complex, class I, G

Gene Aliases

B2 microglobulin; HLA class I histocompatibility antigen, alpha chain G; HLA G antigen; HLA-G histocompatibility antigen, class I, G; MHC class I antigen G; MHC class Ib antigen; MHC-G; mutant MHC class I antigen; mutant MHC class Ib antigen.

Gene ID

3135

Accession Number

NP_002118

Reactivity

Homo sapiens|Human

Target

Involved in the presentation of foreign antigens to the immune system. Plays a role in maternal tolerance of the fetus by mediating protection from the deleterious effects of natural killer cells, cytotoxic T-lymphocytes, macrophages and mononuclear cells.

Type

Protein

Source

Mammalian Cells

Sequence

GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.