Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFTPB Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Surfactant protein B

Gene Aliases

18 kDa pulmonary-surfactant protein;6 kDa protein; PSP-B; pulmonary surfactant-associated protein B; pulmonary surfactant-associated proteolipid SPL (Phe) ; SFTB3; SFTP3; SMDP1; SP-B.

Gene ID

6439

Accession Number

NP_000533

Reactivity

Homo sapiens|Human

Target

Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.

Type

Protein

Source

E.coli

Sequence

FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

24.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SFTPB

Protein Name

Pulmonary surfactant-associated protein B

Gene Name URL

SFTPB

Nucleotide Accession Number

NM_000542

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Mammaglobin A Antibody (MGB/4056) [Biotin]
NBP3-08641B 100 µL

Mouse Monoclonal Mammaglobin A Antibody (MGB/4056) [Biotin]

Sign In for Pricing
View Details
Human CXCL1 ELISA Pair Set
MBS8124266-01 5 Plates

Human CXCL1 ELISA Pair Set

Sign In for Pricing
View Details
Human CXCL1 ELISA Pair Set
MBS8124266-02 15 Plates

Human CXCL1 ELISA Pair Set

Sign In for Pricing
View Details
Human CXCL1 ELISA Pair Set
MBS8124266-03 5x 15 Plates

Human CXCL1 ELISA Pair Set

Sign In for Pricing
View Details
CTPS2 Rabbit Polyclonal Antibody (Biotin)
orb449787 100 µL

CTPS2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Fatty Acid Binding Protein 1, Liver (FABP1) Antibody
abx242337-01 50 µL

Fatty Acid Binding Protein 1, Liver (FABP1) Antibody

Sign In for Pricing
View Details