Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REXO4 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

REX4 homolog, 3'-5' exonuclease

Gene Aliases

Exonuclease XPMC2; Prevents mitotic catastrophe 2 protein homolog; REX4; REX4, RNA exonuclease 4 homolog; RNA exonuclease 4; Xenopus prevents mitotic catastrophe 2 homolog; XPMC2; XPMC2 prevents mitotic catastrophe 2 homolog; XPMC2H.

Gene ID

57109

Accession Number

NP_001266278

Reactivity

Homo sapiens|Human

Type

Protein

Source

E.coli

Sequence

MGKAKVPASKRAPSSPVAKPGPVKTLTRKKNKKKKRFWKSKAREVSKKPASGPGAVVRPPKAPEDFSQNWKALQEWLLKQKSQAPEKPLVISQMGSKKKPKIIQQNKKETSPQVKGEEMPAGKDQEASRGSVPSGSKMDRRAPVPRTKASGTEHNKKGTKERTNGDIVPERGDIEHKKRKAKEAAPAPPTEEDIWFDDVDPADIEAAIGPEAAKIARKQLGQSEGSVSLSLVKEQAFGGLTRALALDCEMVGVGPKGEESMAARVSIVNQYGKCVYDKYVKPTEPVTDYRTAVSGIRPENLKQGEELEVVQKEVAEMLKGRILVGHALHNDLKVLFLDHPKKKIRDTQKYKPFKSQVKSGRPSLRLLSEKILGLQVQQAEHCSIQDAQAAMRLYVMVKKEWESMARDRRPLLTAPDHCSDDA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

62.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

REXO4

Protein Name

RNA exonuclease 4

Gene Name URL

REXO4

Nucleotide Accession Number

NM_001279349

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATOH7 Antibody
orb1254319 100 µL

ATOH7 Antibody

Sign In for Pricing
View Details
Mouse Anti-Human IgE Antibody (AcalephFluor532)
orb3068267-01 100 µL

Mouse Anti-Human IgE Antibody (AcalephFluor532)

Sign In for Pricing
View Details
Mouse Anti-Human IgE Antibody (AcalephFluor532)
orb3068267-02 500 µL

Mouse Anti-Human IgE Antibody (AcalephFluor532)

Sign In for Pricing
View Details
Mouse Anti-Human IgE Antibody (AcalephFluor532)
orb3068267-03 1 mL

Mouse Anti-Human IgE Antibody (AcalephFluor532)

Sign In for Pricing
View Details
LDB1, CT (LDB1, CLIM2, LIM domain-binding protein 1, Carboxyl-terminal LIM domain-binding protein 2, LIM domain-binding factor CLIM2, Nuclear LIM interactor) (APC)
MBS6315559-01 0.2 mL

LDB1, CT (LDB1, CLIM2, LIM domain-binding protein 1, Carboxyl-terminal LIM domain-binding protein 2, LIM domain-binding factor CLIM2, Nuclear LIM interactor) (APC)

Sign In for Pricing
View Details
LDB1, CT (LDB1, CLIM2, LIM domain-binding protein 1, Carboxyl-terminal LIM domain-binding protein 2, LIM domain-binding factor CLIM2, Nuclear LIM interactor) (APC)
MBS6315559-02 5x 0.2 mL

LDB1, CT (LDB1, CLIM2, LIM domain-binding protein 1, Carboxyl-terminal LIM domain-binding protein 2, LIM domain-binding factor CLIM2, Nuclear LIM interactor) (APC)

Sign In for Pricing
View Details