Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cationic trypsin Recombinant Protein (Dog)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Cationic trypsin, EC 3.4.21.4

Reactivity

Canis lupus|Dog

Type

Protein

Source

E.coli

Sequence

IVGGYTCSRNSVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSRIQVRLGEYNIAVSEGGEQFINAAKIIRHPRYNANTIDNDIMLIKLSSPATLNSRVSAIALPKSCPAAGTQCLISGWGNTQSIGQNYPDVLQCLKAPILSDSVCRNAYPGQISSNMMCLGYMEGGKDSCQGDSGGPVVCNGELQGVVSWGAGCAQKGKPGVSPKVCKYVSWIQQTIAAN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.6 kDa

Protein Length

Recombinant

Protein Name

Cationic trypsin

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vezt ORF Vector (Mouse) (pORF)
49492014 1.0 µg DNA

Vezt ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
MYBBP1A Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-61691R-APC-Cy5.5 100 µL

MYBBP1A Recombinant Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
IL1RL2 (IL1RRP2) discontinued
510617 100 µg

IL1RL2 (IL1RRP2) discontinued

Sign In for Pricing
View Details
Rat Coiled-Coil Domain Containing 127 (CCDC127) ELISA Kit
abx505177 96 Tests

Rat Coiled-Coil Domain Containing 127 (CCDC127) ELISA Kit

Sign In for Pricing
View Details
CDCP1, His, Rat
Z06413-500 500 µg

CDCP1, His, Rat

Sign In for Pricing
View Details
MARCHF3 (NM_178450) Human Mass Spec Standard
PH307968 10 µg

MARCHF3 (NM_178450) Human Mass Spec Standard

Sign In for Pricing
View Details