Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cationic trypsin Recombinant Protein (Dog)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Cationic trypsin, EC 3.4.21.4

Reactivity

Canis lupus|Dog

Type

Protein

Source

E.coli

Sequence

IVGGYTCSRNSVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSRIQVRLGEYNIAVSEGGEQFINAAKIIRHPRYNANTIDNDIMLIKLSSPATLNSRVSAIALPKSCPAAGTQCLISGWGNTQSIGQNYPDVLQCLKAPILSDSVCRNAYPGQISSNMMCLGYMEGGKDSCQGDSGGPVVCNGELQGVVSWGAGCAQKGKPGVSPKVCKYVSWIQQTIAAN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.6 kDa

Protein Length

Recombinant

Protein Name

Cationic trypsin

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

frizzled-6 Double Nickase Plasmid (h2)
sc-403185-NIC-2 20 µg

frizzled-6 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Orexin R-2 Lentiviral Activation Particles (m2)
sc-436460-LAC-2 200 µL

Orexin R-2 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
THOC3 Antibody
GWB-29ED59 0.1 mg

THOC3 Antibody

Sign In for Pricing
View Details
Pcdh12 (NM_017378) Mouse Untagged Clone
MC223860 10 µg

Pcdh12 (NM_017378) Mouse Untagged Clone

Sign In for Pricing
View Details
Rabbit MyD88 (Myeloid Differentiation Factor 88) ELISA Kit
MBS8820829-01 48 Well

Rabbit MyD88 (Myeloid Differentiation Factor 88) ELISA Kit

Sign In for Pricing
View Details
Rabbit MyD88 (Myeloid Differentiation Factor 88) ELISA Kit
MBS8820829-02 96 Well

Rabbit MyD88 (Myeloid Differentiation Factor 88) ELISA Kit

Sign In for Pricing
View Details