Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cationic trypsin Recombinant Protein (Dog)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Cationic trypsin, EC 3.4.21.4

Reactivity

Canis lupus|Dog

Type

Protein

Source

E.coli

Sequence

IVGGYTCSRNSVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSRIQVRLGEYNIAVSEGGEQFINAAKIIRHPRYNANTIDNDIMLIKLSSPATLNSRVSAIALPKSCPAAGTQCLISGWGNTQSIGQNYPDVLQCLKAPILSDSVCRNAYPGQISSNMMCLGYMEGGKDSCQGDSGGPVVCNGELQGVVSWGAGCAQKGKPGVSPKVCKYVSWIQQTIAAN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.6 kDa

Protein Length

Recombinant

Protein Name

Cationic trypsin

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine E-Selectin ELISA kit
YLA0145PO-01 48 Tests

Porcine E-Selectin ELISA kit

Sign In for Pricing
View Details
Porcine E-Selectin ELISA kit
YLA0145PO-02 96 Tests

Porcine E-Selectin ELISA kit

Sign In for Pricing
View Details
IQGAP1 (F-7) : m-IgG Fc BP-HRP Bundle
sc-540557 1 Kit

IQGAP1 (F-7) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
(R) -N- (4-cyclohexylbuta-2,3-dien-1-yl) -4-fluorobenzamide
PC110342-01 250 mg

(R) -N- (4-cyclohexylbuta-2,3-dien-1-yl) -4-fluorobenzamide

Sign In for Pricing
View Details
(R) -N- (4-cyclohexylbuta-2,3-dien-1-yl) -4-fluorobenzamide
PC110342-02 1 g

(R) -N- (4-cyclohexylbuta-2,3-dien-1-yl) -4-fluorobenzamide

Sign In for Pricing
View Details
Mouse Heart Whole tissue lysate
MAL-1401 100 µg

Mouse Heart Whole tissue lysate

Sign In for Pricing
View Details