Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STEAP1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

STEAP family member 1

Gene Aliases

Metalloreductase STEAP1; PRSS24; six transmembrane epithelial antigen of the prostate 1; six-transmembrane epithelial antigen of prostate 1; STEAP; STEAP1 metalloreductase.

Gene ID

26872

Accession Number

NP_036581

Reactivity

Homo sapiens|Human

Target

Metalloreductase that has the ability to reduce both Fe (3+) to Fe (2+) and Cu (2+) to Cu (1+) . Uses NAD (+) as acceptor (By similarity) .

Type

Protein

Source

E.coli

Sequence

MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

58.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

STEAP1

Protein Name

Metalloreductase STEAP1

Gene Name URL

STEAP1

Nucleotide Accession Number

NM_012449

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse EphA1 Matched Antibody Pair Set [ABP-S-02888]
ABP-S-02888 5 Plates

Mouse EphA1 Matched Antibody Pair Set [ABP-S-02888]

Sign In for Pricing
View Details
Asbestos TestA5, Concentrate Sulfuric Acid
RE2018-2030 1 Each

Asbestos TestA5, Concentrate Sulfuric Acid

Sign In for Pricing
View Details
Rabbit resistin-like molecule alpha ELISA Kit
MBS7274089-01 48 Well

Rabbit resistin-like molecule alpha ELISA Kit

Sign In for Pricing
View Details
Rabbit resistin-like molecule alpha ELISA Kit
MBS7274089-02 96 Well

Rabbit resistin-like molecule alpha ELISA Kit

Sign In for Pricing
View Details
Rabbit resistin-like molecule alpha ELISA Kit
MBS7274089-03 5x 96 Well

Rabbit resistin-like molecule alpha ELISA Kit

Sign In for Pricing
View Details
Rabbit resistin-like molecule alpha ELISA Kit
MBS7274089-04 10x 96 Well

Rabbit resistin-like molecule alpha ELISA Kit

Sign In for Pricing
View Details