Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Matrix protein 2, partial Recombinant Protein (Influenza A virus)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Proton channel protein M2.

Reactivity

Influenza A Virus

Target

Forms a proton-selective ion channel that is necessary for the efficient release of the viral genome during virus entry. After attaching to the cell surface, the virion enters the cell by endocytosis. Acidification of the endosome triggers M2 ion channel activity. The influx of protons into virion interior is believed to disrupt interactions between the viral ribonucleoprotein (RNP), matrix protein 1 (M1), and lipid bilayers, thereby freeing the viral genome from interaction with viral proteins and enabling RNA segments to migrate to the host cell nucleus, where influenza virus RNA transcription and replication occur. Also plays a role in viral proteins secretory pathway. Elevates the intravesicular pH of normally acidic compartments, such as trans-Golgi network, preventing newly formed hemagglutinin from premature switching to the fusion-active conformation.

Type

Protein

Source

E.coli

Sequence

MSLLTEVETPIRNEWGCRCNGSSDPLVIAASIIGILHLILWILDRLLFKCIYRRFKYGLKRGPSTEGVPESMREEYRKEQQSAVDADDGHFVNIEPE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

15.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

M

Protein Name

Matrix protein 2

Gene Name URL

M

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM177 (NM_001105199) Human Over-expression Lysate
LC426223 20 µg

TMEM177 (NM_001105199) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PREX1 activation kit by CRISPRa
GA111607 1 Kit

Human PREX1 activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL
BNC470034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KIR2DL5A Human Gene Knockout Kit (CRISPR)
KN417119 1 Kit

KIR2DL5A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Adducin 2 (ADD2) (NM_001617) Human Over-expression Lysate
LY419845 100 µg

Adducin 2 (ADD2) (NM_001617) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS647646 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details