Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADK Recombinant Protein (Mycobacterium tuberculosis)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Adenylate monophosphate kinase; ATP:AMP phosphotransferase; ATP-AMP transphosphorylase.

Accession Number

WP_003403726

Reactivity

Mycobacterium tuberculosis

Target

Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism.

Type

Protein

Source

E.coli

Sequence

MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALGK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

36.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ADK

Protein Name

Adenylate kinase

Gene Name URL

ADK

Nucleotide Accession Number

NC_009525

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tuberin (TSC2) (NM_001114382) Human Over-expression Lysate
LC426483 20 µg

Tuberin (TSC2) (NM_001114382) Human Over-expression Lysate

Sign In for Pricing
View Details
Transcription Factor HES-2 (HES2) Human ELISA Kit
H7270 96 Tests

Transcription Factor HES-2 (HES2) Human ELISA Kit

Sign In for Pricing
View Details
Rat Transient Receptor Potential Cation Channel Subfamily M, Member 4 (TRPM4) ELISA Kit
EKN48951 96 Tests

Rat Transient Receptor Potential Cation Channel Subfamily M, Member 4 (TRPM4) ELISA Kit

Sign In for Pricing
View Details
Recombinant Candida albicans NAD (P)H-hydrate epimerase
MBS1152809-01 0.02 mg (E-Coli)

Recombinant Candida albicans NAD (P)H-hydrate epimerase

Sign In for Pricing
View Details
Recombinant Candida albicans NAD (P)H-hydrate epimerase
MBS1152809-02 0.02 mg (Yeast)

Recombinant Candida albicans NAD (P)H-hydrate epimerase

Sign In for Pricing
View Details
Recombinant Candida albicans NAD (P)H-hydrate epimerase
MBS1152809-03 0.1 mg (E-Coli)

Recombinant Candida albicans NAD (P)H-hydrate epimerase

Sign In for Pricing
View Details