Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIA Recombinant Protein (Escherichia coli O6:H1)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Cyclophilin A; Rotamase A.

Accession Number

WP_000477225

Reactivity

Escherichia coli

Target

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity) .

Type

Protein

Source

E.coli

Sequence

AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKVLP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PPIA

Protein Name

Peptidyl-prolyl cis-trans isomerase A

Gene Name URL

PPIA

Nucleotide Accession Number

NC_004431

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Leukotriene B4 Receptor 2 Antibody
NBP1-89960-25ul 25 µL

Rabbit Polyclonal Leukotriene B4 Receptor 2 Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal CD7 Antibody (CD7/3868R) [DyLight 594]
NBP3-24056DL594 0.1 mL

Rabbit Monoclonal CD7 Antibody (CD7/3868R) [DyLight 594]

Sign In for Pricing
View Details
Lentiviral mouse Hccs shRNA (UAS) - Lentiviral mouse Hccs shRNA (UAS, iRFP) plasmid
GTR15178756 1 Vial

Lentiviral mouse Hccs shRNA (UAS) - Lentiviral mouse Hccs shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Mouse Monoclonal Sodium Potassium ATPase Alpha 3 Antibody (XVIF9-G10) [Biotin]
NB300-540B 100 µL

Mouse Monoclonal Sodium Potassium ATPase Alpha 3 Antibody (XVIF9-G10) [Biotin]

Sign In for Pricing
View Details
COL7A1 shRNA Plasmid (m)
sc-43067-SH 20 µg

COL7A1 shRNA Plasmid (m)

Sign In for Pricing
View Details
Human NMT1 knockdown cell line
ABC-KD10190 1 Vial

Human NMT1 knockdown cell line

Sign In for Pricing
View Details