Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRYGB Recombinant Protein (Rat)

Product Specifications

CAS Number

9000-83-3

Gene Name

Crystallin, gamma B

Gene Aliases

Cryg2; CRY-gamma-B; crystallin, gamma polypeptide 2; gamma-B-crystallin; gamma-crystallin 1-2; gamma-crystallin B; Len.

Gene ID

301468

Accession Number

NP_001103345

Reactivity

Rat|Rattus norvegicus

Target

Crystallins are the dominant structural components of the vertebrate eye lens.

Type

Protein

Source

Yeast

Sequence

GKITFFEDRGFQGRCYECSSDCPNLQTYFSRCNSVRVDSGCWMLYERPNYQGHQYFLRRGDYPDYQQWMGFSDSIRSCRLIPQHSGTYRMRIYERDDFRGQMSEITDDCLSLQDRFHLSEIHSLNVMEGCWVLYEMPSYRGRQYLLRPGEYRRYLDWGAANAKVGSFRRVMDFY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

23 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Crygb

Protein Name

Gamma-crystallin B

Gene Name URL

Crygb

Nucleotide Accession Number

NM_001109875

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phosphomevalonate kinase PMVK Rabbit Polyclonal Antibody (Cy3)
orb2579959 100 µg

Phosphomevalonate kinase PMVK Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Lentiviral human SRRT shRNA (UAS) - Lentiviral human SRRT shRNA (UAS, iRFP) plasmid
GTR15325483 1 Vial

Lentiviral human SRRT shRNA (UAS) - Lentiviral human SRRT shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Dnajb8 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6565703 1.0 µg DNA

Dnajb8 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Recombinant Rickettsia typhi Protein-export membrane protein SecG (secG)
orb2934850-01 20 µg

Recombinant Rickettsia typhi Protein-export membrane protein SecG (secG)

Sign In for Pricing
View Details
Recombinant Rickettsia typhi Protein-export membrane protein SecG (secG)
orb2934850-02 100 µg

Recombinant Rickettsia typhi Protein-export membrane protein SecG (secG)

Sign In for Pricing
View Details
PRTG 3'UTR GFP Stable Cell Line
TU068982 1.0 mL

PRTG 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details