What is the catalog number for PROM1 Recombinant Protein (Mouse)?

The catalog number for PROM1 Recombinant Protein (Mouse) is OPCA05265-20UG.

What sizes are available for PROM1 Recombinant Protein (Mouse)?

PROM1 Recombinant Protein (Mouse) is available in the following size(s): 20 µg.

Is PROM1 Recombinant Protein (Mouse) in stock?

PROM1 Recombinant Protein (Mouse) is currently made to order / not held in immediate stock. Contact us for lead time.

PROM1 Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Prominin 1

Gene Aliases

4932416E19Rik; AC13; AC133; antigen AC133 homolog; CD133; P; Pro; Prom; Prom-1; prominin-1; prominin-like 1; prominin-like protein 1; Proml1.

Gene ID

19126

Accession Number

NP_001157050

Reactivity

Mouse|Mus musculus

Target

May play a role in cell differentiation, proliferation and apoptosis. Binds cholesterol in cholesterol-containing plasma membrane microdomains and may play a role in the organization of the apical plasma membrane in epithelial cells. During early retinal development acts as a key regulator of disk morphogenesis (PubMed:19228982) . Involved in regulation of MAPK and Akt signaling pathways. In neuroblastoma cells suppresses cell differentiation such as neurite outgrowth in a RET-dependent manner.

Type

Protein

Source

E.coli

Sequence

GANVEKLLCEPYENKKLLQVLDTPYLLKEQWQFYLSGMLFNNPDINMTFEQVYRDCKRGRGIYAAFQLENVVNVSDHFNIDQISENINTELENLNVNIDSIELLDNTGRKSLEDFAHSGIDTIDYSTYLKETEKSPTEVNLLTFASTLEAKANQLPEGKPKQAFLLDVQNIRAIHQHLLPPVQQSLNTLRQSVWTLQQTSNKLPEKVKKILASLDSVQHFLTNNVSLIVIGETKKFGKTILGYFEHYLHWVFYAITEKMTSCKPMATAMDSAVNGILCGYVADPLN

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol