Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA4 Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Cytotoxic T-lymphocyte-associated protein 4

Gene Aliases

Cd152; CD152 antigen; Ctla; Ctla-4; cytotoxic T-lymphocyte protein 4; cytotoxic T-lymphocyte-associated antigen 4; Ly-5; Ly-56.

Gene ID

12477

Accession Number

NP_033973

Reactivity

Mouse|Mus musculus

Target

Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.

Type

Protein

Source

E.coli

Sequence

EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Ctla4

Protein Name

Cytotoxic T-lymphocyte protein 4

Gene Name URL

Ctla4

Nucleotide Accession Number

NM_009843

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CIDEB (Cell Death Activator CIDE-B, Cell Death-Inducing DFFA-Like Effector B)
478049 100 µL

CIDEB (Cell Death Activator CIDE-B, Cell Death-Inducing DFFA-Like Effector B)

Sign In for Pricing
View Details
Rubella Virus, Grade III
471342 1 mL

Rubella Virus, Grade III

Sign In for Pricing
View Details
Sephacryl S-400 HR
Se-478C 150 mL

Sephacryl S-400 HR

Sign In for Pricing
View Details
Mouse Interleukin 23 Subunit Alpha (IL23a) Mini sample ELISA Kit
EKN52296 96 Tests

Mouse Interleukin 23 Subunit Alpha (IL23a) Mini sample ELISA Kit

Sign In for Pricing
View Details
MIRacle™ hsa-miR-3942-3p miRNA Agomir/Antagomir
AM2438 2 OD, 4 OD, 50 OD

MIRacle™ hsa-miR-3942-3p miRNA Agomir/Antagomir

Sign In for Pricing
View Details
LOC146880 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV813900 1.0 µg DNA

LOC146880 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details