Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA4 Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Cytotoxic T-lymphocyte-associated protein 4

Gene Aliases

Cd152; CD152 antigen; Ctla; Ctla-4; cytotoxic T-lymphocyte protein 4; cytotoxic T-lymphocyte-associated antigen 4; Ly-5; Ly-56.

Gene ID

12477

Accession Number

NP_033973

Reactivity

Mouse|Mus musculus

Target

Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.

Type

Protein

Source

E.coli

Sequence

EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Ctla4

Protein Name

Cytotoxic T-lymphocyte protein 4

Gene Name URL

Ctla4

Nucleotide Accession Number

NM_009843

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ECHS1 (Enoyl-CoA Hydratase, Mitochondrial, Enoyl CoA Hydratase, Short Chain, 1, Mitochondrial)
479862 100 µL

ECHS1 (Enoyl-CoA Hydratase, Mitochondrial, Enoyl CoA Hydratase, Short Chain, 1, Mitochondrial)

Sign In for Pricing
View Details
Sodium octyl sulfate (SOS), 95%
HY-W096997A-01 100 mg

Sodium octyl sulfate (SOS), 95%

Sign In for Pricing
View Details
Sodium octyl sulfate (SOS), 95%
HY-W096997A-02 250 mg

Sodium octyl sulfate (SOS), 95%

Sign In for Pricing
View Details
Sodium octyl sulfate (SOS), 95%
HY-W096997A-03 500 mg

Sodium octyl sulfate (SOS), 95%

Sign In for Pricing
View Details
Sodium octyl sulfate (SOS), 95%
HY-W096997A-04 1 g

Sodium octyl sulfate (SOS), 95%

Sign In for Pricing
View Details
Lentiviral human ZEB1 shRNA (UAS) - Lentiviral human ZEB1 shRNA (UAS, iRFP) plasmid
GTR15091180 1 Vial

Lentiviral human ZEB1 shRNA (UAS) - Lentiviral human ZEB1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details