Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RELG Recombinant Protein (Mycobacterium tuberculosis)

Product Specifications

CAS Number

9000-83-3

Gene Name

Toxin RelG

Gene Aliases

Putative endoribonuclease RelG; relE2; Rv2866; toxin RelG.

Gene ID

887450

Accession Number

NP_217382

Reactivity

Mycobacterium tuberculosis

Target

Toxic component of a type II toxin-antitoxin (TA) system. Has RNase activity and preferentially cleaves at the 3'-end of purine ribonucleotides (By similarity) . Overexpression in M.tuberculosis or M.smegmatis inhibits colony formation in a bacteriostatic rather than bacteriocidal fashion. Its toxic effect is neutralized by coexpression with cognate antitoxin RelB2 (shown only for M.smegmatis) . Overexpression also increases the number of gentamicin-tolerant and levofloxacin-tolerant persister cells.

Type

Protein

Source

E.coli

Sequence

MPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDHRADIYRR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

26.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RelG

Protein Name

Toxin RelG

Gene Name URL

RelG

Nucleotide Accession Number

NC_000962

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS801637 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
ALLC Human Gene Knockout Kit (CRISPR)
KN416471 1 Kit

ALLC Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GAS8 Polyclonal Antibody
E-AB-13260-01 20 µL

GAS8 Polyclonal Antibody

Sign In for Pricing
View Details
GAS8 Polyclonal Antibody
E-AB-13260-02 60 µL

GAS8 Polyclonal Antibody

Sign In for Pricing
View Details
GAS8 Polyclonal Antibody
E-AB-13260-03 120 µL

GAS8 Polyclonal Antibody

Sign In for Pricing
View Details
GAS8 Polyclonal Antibody
E-AB-13260-04 200 µL

GAS8 Polyclonal Antibody

Sign In for Pricing
View Details