FBPB Recombinant Protein (Mycobacterium kansasii)

30 kDa extracellular protein; Acyl-CoA:diacylglycerol acyltransferase; Antigen 85 complex B; esterase family protein; Extracellular alpha-antigen; Fibronectin-binding protein B; MKAN_00750; MKAN_RS00740.

The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria for fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs) . They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan and through the synthesis of alpha, alpha-trehalose dimycolate (TDM, cord factor) . They catalyze the transfer of a mycoloyl residue from one molecule of alpha, alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM (By similarity) .

FSRPGLPVEYLQVPSAAMGRSIKVQFQSGGDNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSVIMPVGGQSSFYSDWYSPACGKAGCTTYKWETFLTSELPQWLSANRSVKPTGSAAVGISMAGSSALILSVYHPQQFIYAGSLSALMDPSQGMGPSLIGLAMGDAGGYKASDMWGPSSDPAWQRNDPSLHIPELVANNTRLWIYCGNGTPSELGGANVPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNLDANGTHSWEYWGAQLNAMKGDLQASLGAR

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.