Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RECR Recombinant Protein (Mycobacterium tuberculosis)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

RecR, MRA_3752, Recombination protein RecR

Accession Number

WP_003420407

Reactivity

Mycobacterium tuberculosis

Target

May play a role in DNA repair. It seems to be involved in an RecBC-independent recombinational process of DNA repair. It may act with RecF and RecO.

Type

Protein

Source

E.coli

Sequence

MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPSDIDRLTGVLAKVRDGVRFCAVCGNVSDNERCRICSDIRRDASVVCIVEEPKDIQAVERTREFRGRYHVLGGALDPLSGIGPDQLRIRELLSRIGERVDDVDVTEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPMGGDLEFADELTLGRALAGRRVLA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

26.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RECR

Protein Name

Recombination protein RecR

Gene Name URL

RECR

Nucleotide Accession Number

NC_009525

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IQ domain-containing protein F6, IQCF6 ELISA Kit
MBS9321227-01 48 Well

Human IQ domain-containing protein F6, IQCF6 ELISA Kit

Sign In for Pricing
View Details
Human IQ domain-containing protein F6, IQCF6 ELISA Kit
MBS9321227-02 96 Well

Human IQ domain-containing protein F6, IQCF6 ELISA Kit

Sign In for Pricing
View Details
Human IQ domain-containing protein F6, IQCF6 ELISA Kit
MBS9321227-03 5x 96 Well

Human IQ domain-containing protein F6, IQCF6 ELISA Kit

Sign In for Pricing
View Details
Human IQ domain-containing protein F6, IQCF6 ELISA Kit
MBS9321227-04 10x 96 Well

Human IQ domain-containing protein F6, IQCF6 ELISA Kit

Sign In for Pricing
View Details
Mucin 16 Double Nickase Plasmid (h2)
sc-403050-NIC-2 20 µg

Mucin 16 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
TIE1 Antibody
orb674570-01 50 µg

TIE1 Antibody

Sign In for Pricing
View Details