What is the catalog number for CLEC4A Recombinant Protein (Mouse)?

The catalog number for CLEC4A Recombinant Protein (Mouse) is OPCA05222-1MG.

What sizes are available for CLEC4A Recombinant Protein (Mouse)?

CLEC4A Recombinant Protein (Mouse) is available in the following size(s): 1 mg.

Is CLEC4A Recombinant Protein (Mouse) in stock?

CLEC4A Recombinant Protein (Mouse) is currently made to order / not held in immediate stock. Contact us for lead time.

CLEC4A Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

C-type lectin domain family 4, member a2

Gene Aliases

Clec4a; Clecs; Clecsf6; C-type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 6; C-type lectin domain family 4 member A; C-type lectin superfamily member 6; DC; Dci; DCIR; Dcir1; dendritic cell immunoreceptor.

Gene ID

26888

Accession Number

NP_001163803

Reactivity

Mouse|Mus musculus

Target

May be involved in regulating immune reactivity. May play a role in modulating dendritic cells (DC) differentiation and/or maturation (By similarity) . May be involved in the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation.

Type

Protein

Source

E.coli

Sequence

QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQMKKINL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.