Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTDP1 Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) phosphatase, subunit 1

Gene Aliases

4930563P03Rik; AW553592; RNA polymerase II subunit A C-terminal domain phosphatase; TFIIF-associating CTD phosphatase.

Gene ID

67655

Accession Number

NP_080571

Reactivity

Mouse|Mus musculus

Target

Processively dephosphorylates 'Ser-2' and 'Ser-5' of the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit. This promotes the activity of RNA polymerase II. Plays a role in the exit from mitosis by dephosphorylating crucial mitotic substrates (USP44, CDC20 and WEE1) that are required for M-phase-promoting factor (MPF) /CDK1 inactivation (By similarity) .

Type

Protein

Source

E.coli

Sequence

HRNRKLVLMVDLDQTLIHTTEQHCPQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECIDPFSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITVKKYVYFPGTGDVNAPPAARETQAR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

24 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Ctdp1

Protein Name

RNA polymerase II subunit A C-terminal domain phosphatase

Gene Name URL

Ctdp1

Nucleotide Accession Number

NM_026295

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SKP1[Biotin], His & Avi, Human
Z04613-100 100 µg

SKP1[Biotin], His & Avi, Human

Sign In for Pricing
View Details
Recombinant Ribonuclease H (RNASEH)
MBS2105250-01 0.01 mg

Recombinant Ribonuclease H (RNASEH)

Sign In for Pricing
View Details
Recombinant Ribonuclease H (RNASEH)
MBS2105250-02 0.05 mg

Recombinant Ribonuclease H (RNASEH)

Sign In for Pricing
View Details
Recombinant Ribonuclease H (RNASEH)
MBS2105250-03 0.1 mg

Recombinant Ribonuclease H (RNASEH)

Sign In for Pricing
View Details
Recombinant Ribonuclease H (RNASEH)
MBS2105250-04 0.2 mg

Recombinant Ribonuclease H (RNASEH)

Sign In for Pricing
View Details
Recombinant Ribonuclease H (RNASEH)
MBS2105250-05 0.5 mg

Recombinant Ribonuclease H (RNASEH)

Sign In for Pricing
View Details