Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HRP1 Recombinant Protein (Mycobacterium tuberculosis)

Product Specifications

CAS Number

9000-83-3

Gene Name

Hypoxic response protein

Gene Aliases

Hypoxic response protein; Rv2626c.

Gene ID

888576

Accession Number

NP_217142

Reactivity

Mycobacterium tuberculosis

Target

Unlike some other CBS-domain containing proteins does not seem to bind AMP.

Type

Protein

Source

E.coli

Sequence

MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALAS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

35.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Hrp1

Protein Name

Hypoxic response protein 1

Gene Name URL

Hrp1

Nucleotide Accession Number

NC_000962

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GYPA ORF Vector (Human) (pORF)
22884011 1.0 µg DNA

GYPA ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
APC_Cy7 Linked Monoclonal Antibody to Epidermal Growth Factor (EGF)
MBS2130004-01 0.1 mL

APC_Cy7 Linked Monoclonal Antibody to Epidermal Growth Factor (EGF)

Sign In for Pricing
View Details
APC_Cy7 Linked Monoclonal Antibody to Epidermal Growth Factor (EGF)
MBS2130004-02 0.2 mL

APC_Cy7 Linked Monoclonal Antibody to Epidermal Growth Factor (EGF)

Sign In for Pricing
View Details
APC_Cy7 Linked Monoclonal Antibody to Epidermal Growth Factor (EGF)
MBS2130004-03 0.5 mL

APC_Cy7 Linked Monoclonal Antibody to Epidermal Growth Factor (EGF)

Sign In for Pricing
View Details
APC_Cy7 Linked Monoclonal Antibody to Epidermal Growth Factor (EGF)
MBS2130004-04 1 mL

APC_Cy7 Linked Monoclonal Antibody to Epidermal Growth Factor (EGF)

Sign In for Pricing
View Details
APC_Cy7 Linked Monoclonal Antibody to Epidermal Growth Factor (EGF)
MBS2130004-05 5 mL

APC_Cy7 Linked Monoclonal Antibody to Epidermal Growth Factor (EGF)

Sign In for Pricing
View Details