Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAF1 Recombinant Protein (Yersinia pestis)

Product Specifications

CAS Number

9000-83-3

Gene Name

F1 capsule antigen

Gene Aliases

D744_p6061; F1 capsule antigen; YPMT1.84.

Gene ID

1149092|1172839

Accession Number

NP_395430

Reactivity

Yersinia pestis

Type

Protein

Source

Yeast

Sequence

ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

17.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Caf1|YPMT1.84

Protein Name

F1 capsule antigen

Gene Name URL

Caf1|YPMT1.84

Nucleotide Accession Number

NC_003134

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDCA4 Rabbit Polyclonal Antibody
TA365614 100 µL

CDCA4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ESM1 (Endothelial Cell Specific Molecule 1) CLIA Kit
E-CL-H1000-01 24 Tests

Human ESM1 (Endothelial Cell Specific Molecule 1) CLIA Kit

Sign In for Pricing
View Details
Human ESM1 (Endothelial Cell Specific Molecule 1) CLIA Kit
E-CL-H1000-02 48 Tests

Human ESM1 (Endothelial Cell Specific Molecule 1) CLIA Kit

Sign In for Pricing
View Details
Human ESM1 (Endothelial Cell Specific Molecule 1) CLIA Kit
E-CL-H1000-03 96 Tests

Human ESM1 (Endothelial Cell Specific Molecule 1) CLIA Kit

Sign In for Pricing
View Details
FITC Conjugated Rabbit Polyclonal Antibody to Laminin (Mouse EHS Sarcoma)
FA-2404-1 1 mL

FITC Conjugated Rabbit Polyclonal Antibody to Laminin (Mouse EHS Sarcoma)

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS700896 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details