Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LUSH Recombinant Protein (Fruit fly)

Product Specifications

CAS Number

9000-83-3

Gene Name

Lush

Gene Aliases

76a;76c;76c (LUSH) ; CG8807; CG8807-PA; CG8807-PB; Dmel\CG8807; Dmel_CG8807; DmelOBP76a; lush; lush-PA; lush-PB; Obp76a.

Gene ID

40136

Accession Number

NP_001163468

Reactivity

Drosophila melanogaster

Target

Odorant-binding protein required for olfactory behavior and for activity of pheromone-sensitive neurons. Binds to alcohols and mediates avoidance behavior to high concentrations of alcohols, the alcohol-binding possibly resulting in activation of receptors on T2B neurons, the activation of these receptors inhibiting these neurons. Acts in concert with Snmp and lush to capture cVA molecules on the surface of Or67d expressing olfactory dendrites and facilitate their transfer to the odorant-receptor Orco complex. Required for cVA response, probably by binding to VA. May act by serving as an adapter that bridges the presence of gaseous pheromone molecules, cVA, to activation of specific neuronal receptors expressed on T1 olfactory neurons, possibly via a specific conformational change induced by cVA that in turn activates T1 receptors. T1 neurons are excited by the pheromone VA, while T2 neurons are inhibited by alcohols. Also binds to phthalates.

Type

Protein

Source

E.coli

Sequence

MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

Varies by lot. See vial for exact concentration.

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

19.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Lush

Protein Name

General odorant-binding protein lush

Gene Name URL

Lush

Nucleotide Accession Number

NM_001169997

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCS 2314
MBS5755602 Inquire

TCS 2314

Sign In for Pricing
View Details
3-Carboxy-2,2,5,5-tetramethyl-3-pyrrolin-1-yloxy, Free Radical
C1215-10 100 mg

3-Carboxy-2,2,5,5-tetramethyl-3-pyrrolin-1-yloxy, Free Radical

Sign In for Pricing
View Details
Lentiviral human DACH2 shRNA (UAS) - Lentiviral human DACH2 shRNA (UAS, iRFP) (100)
GTR15322554 1 Vial

Lentiviral human DACH2 shRNA (UAS) - Lentiviral human DACH2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Lentiviral mouse Ube2u shRNA (UAS) - Lentiviral mouse Ube2u shRNA (UAS, iRFP) (100)
GTR15258087 1 Vial

Lentiviral mouse Ube2u shRNA (UAS) - Lentiviral mouse Ube2u shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
N-2- (Hydroxyethyl) -L-valine
279415-01 25 mg

N-2- (Hydroxyethyl) -L-valine

Sign In for Pricing
View Details
N-2- (Hydroxyethyl) -L-valine
279415-02 50 mg

N-2- (Hydroxyethyl) -L-valine

Sign In for Pricing
View Details