Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOE Recombinant Protein (Rabbit)

Product Specifications

CAS Number

9000-83-3

Gene Name

Apolipoprotein E

Gene Aliases

Apo-E; apolipoprotein E.

Gene ID

100009337

Accession Number

NP_001076112

Reactivity

Oryctolagus cuniculus|Rabbit

Target

Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues.

Type

Protein

Source

E.coli

Sequence

TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

APOE

Protein Name

Apolipoprotein E

Gene Name URL

APOE

Nucleotide Accession Number

NM_001082643

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Visinin Like Protein 1 (VSNL1) ELISA Kit
abx153492-01 96 Tests

Human Visinin Like Protein 1 (VSNL1) ELISA Kit

Sign In for Pricing
View Details
Human Visinin Like Protein 1 (VSNL1) ELISA Kit
abx153492-02 5x 96 Tests

Human Visinin Like Protein 1 (VSNL1) ELISA Kit

Sign In for Pricing
View Details
Human Visinin Like Protein 1 (VSNL1) ELISA Kit
abx153492-03 10x 96 Tests

Human Visinin Like Protein 1 (VSNL1) ELISA Kit

Sign In for Pricing
View Details
Mouse Ly-6C Rat mAb, FITC conjugated
orb1184256-01 25 Tests

Mouse Ly-6C Rat mAb, FITC conjugated

Sign In for Pricing
View Details
Mouse Ly-6C Rat mAb, FITC conjugated
orb1184256-02 50 Tests

Mouse Ly-6C Rat mAb, FITC conjugated

Sign In for Pricing
View Details
Mouse Ly-6C Rat mAb, FITC conjugated
orb1184256-03 100 Tests

Mouse Ly-6C Rat mAb, FITC conjugated

Sign In for Pricing
View Details