Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADK Recombinant Protein (Shigella flexneri)

Product Specifications

CAS Number

9000-83-3

Gene Name

Adenylate kinase

Gene Aliases

Adenylate monophosphate kinase; ATP:AMP phosphotransferase; ATP-AMP transphosphorylase; SF0419.

Gene ID

1027707

Accession Number

NP_706367

Reactivity

Shigella flexneri

Target

Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism.

Type

Protein

Source

E.coli

Sequence

MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKQVAEVRADLEKILG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

43.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Adk

Protein Name

Adenylate kinase

Gene Name URL

Adk

Nucleotide Accession Number

NC_004337

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

protein 3A (NC_010810) Virus Tagged ORF Clone
VC102174 10 µg

protein 3A (NC_010810) Virus Tagged ORF Clone

Sign In for Pricing
View Details
RAB27B Protein, Human, Recombinant
MBS8121982-01 0.1 mg

RAB27B Protein, Human, Recombinant

Sign In for Pricing
View Details
RAB27B Protein, Human, Recombinant
MBS8121982-02 5x 0.1 mg

RAB27B Protein, Human, Recombinant

Sign In for Pricing
View Details
Chicken B cell activating factor belonging to the TNF family (BAFF) ELISA Kit
MBS267970-01 48 Well

Chicken B cell activating factor belonging to the TNF family (BAFF) ELISA Kit

Sign In for Pricing
View Details
Chicken B cell activating factor belonging to the TNF family (BAFF) ELISA Kit
MBS267970-02 96 Well

Chicken B cell activating factor belonging to the TNF family (BAFF) ELISA Kit

Sign In for Pricing
View Details
Chicken B cell activating factor belonging to the TNF family (BAFF) ELISA Kit
MBS267970-03 5x 96 Well

Chicken B cell activating factor belonging to the TNF family (BAFF) ELISA Kit

Sign In for Pricing
View Details