Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALGL Recombinant Protein (Azotobacter vinelandii)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Poly (beta-D-mannuronate) lyase.

Accession Number

WP_012699742

Reactivity

Azotobacter vinelandii

Target

Catalyzes the depolymerization of alginate by cleaving the beta-1,4 glycosidic bond between two adjacent sugar residues via a beta-elimination mechanism. Splits ManA-ManA and ManA-GulA bonds, but not GulA-ManA or GulA-GulA bonds. Also cleaves acetylated residues (PubMed:9683471) . May serve to degrade mislocalized alginate that is trapped in the periplasmic space (By similarity) .

Type

Protein

Source

E.coli

Sequence

AEALVPPKGYYAPVDIRKGEAPACPVVPEPFTGELVFRSKYEGSDAARSTLNEEAEKAFRTKTAPITQIERGVSRMVMRYMEKGRAGDLECTLAWLDAWAEDGALLTTEYNHTGKSMRKWALGSLAGAYLRLKFSSSQPLAAYPEQARRIESWFAKVGDQVIKDWSDLPLKRINNHSYWAAWAVMAAGVATNRRPLFDWAVEQFHIAAGQVDSNGFLPNELKRRQRALAYHNYSLPPLMMVAAFALANGVDLRGDNDGALGRLAGNVLAGVEKPEPFAERAGDEDQDMEDLETDAKFSWLEPYCALYSCSPALRERKAEMGPFKNFRLGGDVTRIFDPAEKSPRSTVGKRD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

59 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ALGL

Protein Name

Alginate lyase

Gene Name URL

ALGL

Nucleotide Accession Number

NZ_FPKM01000036

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB11FIP4 (NM_032932) Human Recombinant Protein
TP310877M 100 µg

RAB11FIP4 (NM_032932) Human Recombinant Protein

Sign In for Pricing
View Details
TRPM3 Human qPCR Primer Pair (XM_036123)
HP220764 200 Reactions

TRPM3 Human qPCR Primer Pair (XM_036123)

Sign In for Pricing
View Details
PCMV-IDO1 (human) -EGFP-Neo
BZ50701 1 Vial

PCMV-IDO1 (human) -EGFP-Neo

Sign In for Pricing
View Details
LRRC8B Human shRNA Plasmid Kit (Locus ID 23507)
TR303437 1 Kit

LRRC8B Human shRNA Plasmid Kit (Locus ID 23507)

Sign In for Pricing
View Details
CKM (Creatine Kinase, Muscle) BioAssayTM ELISA Kit (Mouse) discontinued
382385 96 Tests

CKM (Creatine Kinase, Muscle) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
Tnfrsf26-set siRNA/shRNA/RNAi Lentivector (Rat)
47216096 4x 500 ng

Tnfrsf26-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details