Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FXN Recombinant Protein (Rat)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

FxnFrataxin, mitochondrial, Fxn, EC 1.16.3.1) [Cleaved into: Frataxin intermediate form, Frataxin mature form]

Reactivity

Rat|Rattus norvegicus

Target

Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe (2+) to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe (2+) to Fe (3+) ; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Modulates the RNA-binding activity of ACO1 (By similarity) .

Type

Protein

Source

E.coli

Sequence

LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALNTKLDLSSLAYSGKGT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

22.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FXN

Protein Name

Frataxin, mitochondrial

Gene Name URL

FXN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rras2 Mouse siRNA Oligo Duplex (Locus ID 66922)
SR405257 1 Kit

Rras2 Mouse siRNA Oligo Duplex (Locus ID 66922)

Sign In for Pricing
View Details
Glucosidase Beta, Acid (GbA) BioAssayTM ELISA Kit (Human) (Wide Range)
517242 96 Tests

Glucosidase Beta, Acid (GbA) BioAssayTM ELISA Kit (Human) (Wide Range)

Sign In for Pricing
View Details
KCNMB4 CRISPRa sgRNA lentivector (set of three targets)(Rat)
25412126 3x 1.0µg DNA

KCNMB4 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
PSG9, ID (PSG9,PSG11) (MaxLight 490)
MBS6338134-01 0.1 mL

PSG9, ID (PSG9,PSG11) (MaxLight 490)

Sign In for Pricing
View Details
PSG9, ID (PSG9,PSG11) (MaxLight 490)
MBS6338134-02 5x 0.1 mL

PSG9, ID (PSG9,PSG11) (MaxLight 490)

Sign In for Pricing
View Details
ZAP70 peptide
orb218109-01 1 mg

ZAP70 peptide

Sign In for Pricing
View Details