Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Defensin-like protein 1 Recombinant Protein (Bedding dahlia)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Cysteine-rich antimicrobial protein 1; Defensin AMP1.

Reactivity

Dahlia merckii

Target

Possesses antimicrobial activity sensitive to inorganic cations. Has no inhibitory effect on insect gut alpha-amylase. Induces potential changes in fungal membranes and increased K+ efflux and Ca (2+) uptake. Interacts with sphingolipids and ergosterols found in fungal plasma membranes.

Type

Protein

Source

E.coli

Sequence

ELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHMCFCYFNC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

19.5 kDa

Protein Length

Recombinant

Protein Name

Defensin-like protein 1

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXL21 Protein Lysate (Human) with C-Ha Tag
20300031 100 µg

FBXL21 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Lucatumumab Biosimilar - Research Grade
ICH5129-100mg 100 mg

Lucatumumab Biosimilar - Research Grade

Sign In for Pricing
View Details
SORBS1 Protein Vector (Mouse) (pPB-N-His)
PV232663 500 ng

SORBS1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Rabbit Polyclonal JAM-C Antibody
NBP3-29828 100 µg

Rabbit Polyclonal JAM-C Antibody

Sign In for Pricing
View Details
NME5 ORF Vector (Human) (pORF)
ORF007118 1.0 µg DNA

NME5 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Slc32a1 siRNA Oligos set (Mouse)
44122174 3x 5 nmol

Slc32a1 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details