Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRCA Recombinant Protein (Neisseria meningitidis serogroup B)

Product Specifications

CAS Number

9000-83-3

Gene Name

Penicillin-binding protein 1A

Gene Aliases

NMB_RS09430; NMB1807; penicillin-binding protein 1A.

Gene ID

903291

Accession Number

NP_274804

Reactivity

Neisseria meningitidis

Target

Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits) .

Type

Protein

Source

E.coli

Sequence

KAPSAYNPIVNPERAKLRQKYILNNMLEEKMITVQQRDQALNEELHYERFVRKIDQSALYVAEMVRQELYEKYGEDAYTQGFKVYTTVRADHQKVATEALRKALRNFDRGSSYRGAENYIDLSKSEDVEETVSQYLSGLYTVDKMVPAVVLDVTKKKNVVIQLPGGRRVTLDRRALGFAARAVNNEKMGEDRIRRGAVIRVKNNGGRW

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40 kDa

Protein Length

Recombinant

NCBI Gene Symbol

NMB_RS09430

Protein Name

Penicillin-binding protein 1A

Gene Name URL

NMB_RS09430

Nucleotide Accession Number

NC_003112

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-DOB, 27-224aa, Human, His tag, E Coli (Denatured)
MBS205672-01 0.02 mg

HLA-DOB, 27-224aa, Human, His tag, E Coli (Denatured)

Sign In for Pricing
View Details
HLA-DOB, 27-224aa, Human, His tag, E Coli (Denatured)
MBS205672-02 0.1 mg

HLA-DOB, 27-224aa, Human, His tag, E Coli (Denatured)

Sign In for Pricing
View Details
HLA-DOB, 27-224aa, Human, His tag, E Coli (Denatured)
MBS205672-03 5x 0.02 mg

HLA-DOB, 27-224aa, Human, His tag, E Coli (Denatured)

Sign In for Pricing
View Details
HLA-DOB, 27-224aa, Human, His tag, E Coli (Denatured)
MBS205672-04 0.5 mg

HLA-DOB, 27-224aa, Human, His tag, E Coli (Denatured)

Sign In for Pricing
View Details
HLA-DOB, 27-224aa, Human, His tag, E Coli (Denatured)
MBS205672-05 5x 0.1 mg

HLA-DOB, 27-224aa, Human, His tag, E Coli (Denatured)

Sign In for Pricing
View Details
HLA-DOB, 27-224aa, Human, His tag, E Coli (Denatured)
MBS205672-06 5x 0.5 mg

HLA-DOB, 27-224aa, Human, His tag, E Coli (Denatured)

Sign In for Pricing
View Details