GFER Recombinant Protein (Rat)
Product Specifications
CAS Number
9000-83-3
Gene Name
Growth factor, augmenter of liver regeneration
Gene Aliases
ALR; augmenter of liver regeneration; FAD-linked sulfhydryl oxidase ALR; FAD-linked sulfhydryl oxidase ALR-like; growth factor, erv1 homolog; growth factor, erv1-like (augmenter of liver regeneration) ; translation initiation factor IF-2-like.
Gene ID
27100
Accession Number
NP_037354
Reactivity
Rat|Rattus norvegicus
Target
FAD-dependent sulfhydryl oxidase that regenerates the redox-active disulfide bonds in CHCHD4/MIA40, a chaperone essential for disulfide bond formation and protein folding in the mitochondrial intermembrane space. The reduced form of CHCHD4/MIA40 forms a transient intermolecular disulfide bridge with GFER/ERV1, resulting in regeneration of the essential disulfide bonds in CHCHD4/MIA40, while GFER/ERV1 becomes re-oxidized by donating electrons to cytochrome c or molecular oxygen. May have a function in liver regeneration and spermatogenesis.
Type
Protein
Source
E.coli
Sequence
MAAPSEPAGFPRGSRFSFLPGGAHSEMTDDLVTDARGRGARHRKDNAPAAAPAPKGLEHGKRPCRACVDFKSWMRTQQKRDIKFREDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions
Reconstitution & Storage Instructions
Western Blotting/Immunoblotting (WB/IB) Protocol
Western Blotting/Immunoblotting (WB/IB) Protocol
Immunohistochemistry (IHC) Protocol
Immunohistochemistry (IHC) Protocol
Immunocytochemistry (ICC) Protocol
Immunocytochemistry (ICC) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Blocking Peptide Competition Protocol (BPCP)
Blocking Peptide Competition Protocol (BPCP)
Immunoprecipitation (IP) Protocol
Immunoprecipitation (IP) Protocol
Antibody Array (AA) Protocol
Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
38.8 kDa
Protein Length
Recombinant
NCBI Gene Symbol
Gfer
Protein Name
FAD-linked sulfhydryl oxidase ALR
Gene Name URL
Gfer
Nucleotide Accession Number
NM_013222
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx270014-01 50 Tests
T-Cell Surface Glycoprotein CD3 Epsilon Chain (CD3E) Antibody
Sign In for Pricing
View Details abx270014-02 100 Tests
T-Cell Surface Glycoprotein CD3 Epsilon Chain (CD3E) Antibody
Sign In for Pricing
View Details abx270014-03 200 Tests
T-Cell Surface Glycoprotein CD3 Epsilon Chain (CD3E) Antibody
Sign In for Pricing
View Details abx270014-04 500 Tests
T-Cell Surface Glycoprotein CD3 Epsilon Chain (CD3E) Antibody
Sign In for Pricing
View Details 
FCSTM20-37 1 Kit
Mouse XL Cytokine Premixed Kit Luminex Performance Assay
Sign In for Pricing
View Details 
P3112-02P-ML490 100 µL
Parkin, phosphorylated (Ser378) (AR-JP, E3 Ubiquitin Protein Ligase Parkin, FRA6E, LPRS2, Parkinson Disease (Autosomal Recessive, Juvenile) 2, Parkinson Disease Protein 2, Parkinson Juvenile Disease Protein 2, PARK2, PRKN 2, PRKN, PDJ, RING-type E3 Ubiquitin-protein Ligase, Ubiquitin E3 Ligase PRKN) (MaxLight 490) discontinued
Sign In for Pricing
View Details