Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM3 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

CEA cell adhesion molecule 3

Gene Aliases

Carcinoembryonic antigen CGM1; carcinoembryonic antigen gene family member 1; carcinoembryonic antigen related cell adhesion molecule 3; carcinoembryonic antigen-related cell adhesion molecule 3; CD66D; CD66d antigen; CEA; CGM1; nonspecific cross-reacting antigen; W264; W282.

Gene ID

1084

Reactivity

Homo sapiens|Human

Target

Major granulocyte receptor mediating recognition and efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms, including Neissiria, Moxarella and Haemophilus species, thus playing an important role in the clearance of pathogens by the innate immune system. Responsible for RAC1 stimulation in the course of pathogen phagocytosis.

Type

Protein

Source

E.coli

Sequence

KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

29.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CEACAM3

Protein Name

Carcinoembryonic antigen-related cell adhesion molecule 3

Gene Name URL

CEACAM3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PABPC5 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
35911064 1.0 µg DNA

PABPC5 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Apolipoprotein C3 (APOC3) Antibody (Biotin)
abx105157-01 20 µg

Apolipoprotein C3 (APOC3) Antibody (Biotin)

Sign In for Pricing
View Details
Apolipoprotein C3 (APOC3) Antibody (Biotin)
abx105157-02 50 µg

Apolipoprotein C3 (APOC3) Antibody (Biotin)

Sign In for Pricing
View Details
Apolipoprotein C3 (APOC3) Antibody (Biotin)
abx105157-03 100 µg

Apolipoprotein C3 (APOC3) Antibody (Biotin)

Sign In for Pricing
View Details
Apolipoprotein C3 (APOC3) Antibody (Biotin)
abx105157-04 200 µg

Apolipoprotein C3 (APOC3) Antibody (Biotin)

Sign In for Pricing
View Details
Apolipoprotein C3 (APOC3) Antibody (Biotin)
abx105157-05 1 mg

Apolipoprotein C3 (APOC3) Antibody (Biotin)

Sign In for Pricing
View Details