Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FUCA1 Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Fucosidase, alpha-L- 1, tissue

Gene Aliases

0610006A03Rik;9530055J05Rik; Afu; Afuc; alpha-L-fucosidase 1; alpha-L-fucosidase I; alpha-L-fucoside fucohydrolase 1; Fuca; tissue alpha-L-fucosidase.

Gene ID

71665

Accession Number

NP_077205

Reactivity

Mouse|Mus musculus

Target

Alpha-L-fucosidase is responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins.

Type

Protein

Source

E.coli

Sequence

LAPRRFTPDWQSLDSRPLPSWFDEAKFGVFVHWGVFSVPAWGSEWFWWHWQGDRMPAYQRFMTENYPPGFSYADFAPQFTARFFHPDQWAELFQAAGAKYVVLTTKHHEGFTNWPSPVSWNWNSKDVGPHRDLVGELGAAVRKRNIRYGLYHSLLEWFHPLYLLDKKNGFKTQHFVRAKTMPELYDLVNSYKPDLIWSDGEWECPDTYWNSTSFLAWLYNDSPVKDEVIVNDRWGQNCSCHHGGYYNCQDKYKPQSLPDHKWEMCTSMDRASWGYRKDMTMSTIAKENEIIEELVQTVSLGGNYLLNIGPTKDGLIVPIFQERLLAVGKWLQINGEAIYASKPWRVQSEKNKTVVWYTTKNATVYATFLYWPENGIVNLKSPKTTSATKITMLGLEGDLSWTQDPLEGVLISLPQLPPTVLPVEFAWTLKLTKVN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

66.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Fuca1

Protein Name

Tissue alpha-L-fucosidase

Gene Name URL

Fuca1

Nucleotide Accession Number

NM_024243

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCF4 Antibody / Transcription factor 4
RQ7105 100 µg

TCF4 Antibody / Transcription factor 4

Sign In for Pricing
View Details
Slfn11 (E-4) HRP
sc-374339 HRP 200 µg/mL

Slfn11 (E-4) HRP

Sign In for Pricing
View Details
Mouse CYBB/Cytochrome b-245 Heavy Chain ELISA Kit
MBS2889779-01 48 Well

Mouse CYBB/Cytochrome b-245 Heavy Chain ELISA Kit

Sign In for Pricing
View Details
Mouse CYBB/Cytochrome b-245 Heavy Chain ELISA Kit
MBS2889779-02 96 Well

Mouse CYBB/Cytochrome b-245 Heavy Chain ELISA Kit

Sign In for Pricing
View Details
Mouse CYBB/Cytochrome b-245 Heavy Chain ELISA Kit
MBS2889779-03 5x 96 Well

Mouse CYBB/Cytochrome b-245 Heavy Chain ELISA Kit

Sign In for Pricing
View Details
Mouse CYBB/Cytochrome b-245 Heavy Chain ELISA Kit
MBS2889779-04 10x 96 Well

Mouse CYBB/Cytochrome b-245 Heavy Chain ELISA Kit

Sign In for Pricing
View Details